PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1196s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 398aa    MW: 44764.9 Da    PI: 6.5122
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1196s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.61.9e-56161431129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lp+GfrFhPtdee++++yL++kv ++ + +  +i evd++k+ePwdLp k+k +e+ewyfF++rd+ky+tg r+nrat+sgyWkatg
  SapurV1A.1196s0010.1.p  16 LPAGFRFHPTDEEIITHYLTEKVMKSGFCA-IAIGEVDLNKCEPWDLPDKAKMGENEWYFFCQRDRKYPTGMRTNRATESGYWKATG 101
                             799************************888.78***************99999********************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             kdke+++ k+ lvg+kktLvfy+grapkgekt+Wvmheyrle
  SapurV1A.1196s0010.1.p 102 KDKEIYRGKNCLVGMKKTLVFYRGRAPKGEKTSWVMHEYRLE 143
                             *******99999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6410167IPR003441NAC domain
PROSITE profilePS5100558.70216167IPR003441NAC domain
PfamPF023652.4E-2917142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MEEAVVVNTG DDQMNLPAGF RFHPTDEEII THYLTEKVMK SGFCAIAIGE VDLNKCEPWD  60
LPDKAKMGEN EWYFFCQRDR KYPTGMRTNR ATESGYWKAT GKDKEIYRGK NCLVGMKKTL  120
VFYRGRAPKG EKTSWVMHEY RLEGKFSYHS LPKVARDEWV VCRIFHKSTG VKKTSIHDLR  180
RMNSFGDDFL DYSSLPPLMD PPTYTSRPGT SSFSDADNNE FKAMTTSGSS DGNYLANSSM  240
LNNNQNFVRP LNTIYQTPNS SFHLQNPASN PLYSFQTNPN MPVHLHQGRN TSSFPNFQNS  300
TFGNNDQTLL RALATGEIYG ESSNLLEKQC KVEQFSSNQS MVSLSQDSTG LSTDVNTAAE  360
ISSVVSKQEI GSHNKFYDNL EGPLAGAIAD LDYLLNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-521317317174NAC domain-containing protein 19
3swm_B1e-521317317174NAC domain-containing protein 19
3swm_C1e-521317317174NAC domain-containing protein 19
3swm_D1e-521317317174NAC domain-containing protein 19
3swp_A1e-521317317174NAC domain-containing protein 19
3swp_B1e-521317317174NAC domain-containing protein 19
3swp_C1e-521317317174NAC domain-containing protein 19
3swp_D1e-521317317174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2167711e-112AC216771.1 Populus trichocarpa clone POP051-N07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375881.10.0hypothetical protein POPTR_0013s05110g
SwissprotQ9FLJ21e-101NC100_ARATH; NAC domain-containing protein 100
TrEMBLU5FR640.0U5FR64_POPTR; Uncharacterized protein
STRINGPOPTR_0013s05110.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.21e-112Arabidopsis NAC domain containing protein 87